PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC587_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 370aa    MW: 41359.5 Da    PI: 8.2561
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC587_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.44.4e-1753113257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                + R+++++eq+++Le+ F++   +p +ee++++ ++l    ++ ++ V++WFqNr+ + k+
  RrC587_p1  53 KLRWNPKPEQIRILEAIFNSgMVNPPREEIRRIRAQLqeygQVGDASVFYWFQNRKSRSKN 113
                78*****************99*************************************995 PP

2Wus_type_Homeobox107.29.8e-3553114364
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        + RW+P+peQi+iLe++++sG+++P++eei+ri+a+L+eyG+++d+ VfyWFQNrk+R+++k
          RrC587_p1  53 KLRWNPKPEQIRILEAIFNSGMVNPPREEIRRIRAQLQEYGQVGDASVFYWFQNRKSRSKNK 114
                        78**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-633113IPR009057Homeodomain-like
PROSITE profilePS5007110.46349114IPR001356Homeobox domain
SuperFamilySSF466891.54E-1150117IPR009057Homeodomain-like
SMARTSM003891.6E-751118IPR001356Homeobox domain
CDDcd000861.14E-752114No hitNo description
PfamPF000469.1E-1553112IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPHHHQ WQHDINSPLL PSSASHRSSP FSGCEVERSP EPKLRWNPKP  60
EQIRILEAIF NSGMVNPPRE EIRRIRAQLQ EYGQVGDASV FYWFQNRKSR SKNKLRLLHK  120
HSLSQPQPQP QPSSSSSSSS SKSTKPQKNK DKNNNNLSLG GSQMMGMFPS EAALPFPVST  180
AVAFEGITVS SQLGFLSGDM KPAPPTVEPC TDYLLSEIMN GSVSYGTYHH QHLSEKEDEE  240
MRMKMLQQPQ PYATTSNQIT SYNNNNIILH VPPITSTTTT TITTSDSLGI VPSASDQLQV  300
QVGTRIRVFI NEMEFEVRPG PFNVRDAFGE EVFLINSAGQ PFVTDEYGVA LQPLQHGASY  360
YLVLFSLLAS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2411460.0AC241146.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH072P15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009132965.10.0PREDICTED: WUSCHEL-related homeobox 9-like isoform X2
SwissprotQ6X7J40.0WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLM4E2F90.0M4E2F9_BRARP; Uncharacterized protein
STRINGBra022960.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72062640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.11e-164homeobox-3